Structure of PDB 8k4l Chain B Binding Site BS02

Receptor Information

>8k4l Chain B (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HVFESNPSIRKRQQTRLLRKLRATLDEYTTRVGQQAIVLCISPSKPNPVF
KVFGAAPLENVVRKYKSMILEDLESALASELPPLTIDGIPVSVDKMTQAQ
LRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQ
RVSWTQALRTIVKNCYKQHGREDLLYAF

Ligand information

>8k4l Chain D (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

atgcgcatgcgcat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8k4l Crystal structure of NRF1 homodimer in complex with DNA
Resolution	2.1 Å
Binding residue (original residue number in PDB)	A207 P210 K221 P222 G223 W224 N242 R244
Binding residue (residue number reindexed from 1)	A103 P106 K117 P118 G119 W120 N138 R140

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006357	regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8k4l, PDBe:8k4l, PDBj:8k4l
PDBsum	8k4l
PubMed	38055835
UniProt	Q16656\|NRF1_HUMAN Nuclear respiratory factor 1 (Gene Name=NRF1)

[Back to BioLiP]