Structure of PDB 8j70 Chain B Binding Site BS02

Receptor Information
>8j70 Chain B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVDFKAPLLPVTCGGVKGILHKKKLQQGILVKCIQTEDGKWFTPTEFEIK
GGHARSKNWRLSVRCGGWPLRWLMENGFLPDPPRIRY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j70 Molecular basis for Speckled protein SP140 bivalent recognition of histone H3 and DNA.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		I610 K638 N639 W640 R641 R665
Binding residue
(residue number reindexed from 1)		I29 K57 N58 W59 R60 R84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:8j70, PDBe:8j70, PDBj:8j70
PDBsum8j70
PubMed
UniProtQ13342|SP140_HUMAN Nuclear body protein SP140 (Gene Name=SP140)

[Back to BioLiP]