Structure of PDB 8j62 Chain B Binding Site BS02

Receptor Information
>8j62 Chain B (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHMDPDTFSYNFNNRPILSRRNTVWLCYEVERLDNGTWVKMDQHRGQVYS
ELKYHPEMRFLSLVSKWKLHRDQEYEVTWYISWSPCTKCARDMATFLQEN
THVTLTIFVARLYYFWDPDYQEALRSLAQAGATIKIMNYDEFQHCWSKFV
YSQGAPFQPWDGLDEYSQALSGMLGEILRH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j62 Structural insights into RNA bridging between HIV-1 Vif and antiviral factor APOBEC3G.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		H0 T5 Y8 N9 R13 I15 L16 S17 R18 N20 T21 Y47 S48 E49 L50 W81 Y111 Y112 F113 W114
Binding residue
(residue number reindexed from 1)		H2 T7 Y10 N11 R15 I17 L18 S19 R20 N22 T23 Y49 S50 E51 L52 W83 Y113 Y114 F115 W116
Enzymatic activity
Enzyme Commision number 3.5.4.38: single-stranded DNA cytosine deaminase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity

View graph for
Molecular Function
External links
PDB RCSB:8j62, PDBe:8j62, PDBj:8j62
PDBsum8j62
PubMed37419875
UniProtQ9HC16|ABC3G_HUMAN DNA dC->dU-editing enzyme APOBEC-3G (Gene Name=APOBEC3G)

[Back to BioLiP]