Structure of PDB 8j0f Chain B Binding Site BS02

Receptor Information
>8j0f Chain B (length=270) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IDRSRAFAKDVKRIVVKVGTAVVTGKGGRLALGRLGAICEQLAELNSDGF
EVILVSSGAVGLGRQRLRYRQLVNSSFADLQKPQMELDGKACAGVGQSSL
MAYYETMFDQLDVTVAQMLVTDSSFRDKDFRKQLSETVKAMLRMRVIPVF
NENDAISTRWDNDSLAALLSLELKADLLILLSDVEGLYTGPPSDSTSKLI
HTFIKEKHQDEITFGERGGMTAKVKAAVNAAYGGVPVIITSGYAAENISK
VLRGLRVGTLFHQDAHLWAP
Ligand information
>8j0f Chain H (length=15) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YRQLVNSSFADLQKP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j0f GK tetramer with adjacent hooks at reaction state
Resolution3.3 Å
Binding residue
(original residue number in PDB)
L75 F80 L83
Binding residue
(residue number reindexed from 1)
L72 F77 L80
Enzymatic activity
Enzyme Commision number 1.2.1.41: glutamate-5-semialdehyde dehydrogenase.
2.7.2.11: glutamate 5-kinase.
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0004349 glutamate 5-kinase activity
GO:0004350 glutamate-5-semialdehyde dehydrogenase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
Biological Process
GO:0006561 proline biosynthetic process
GO:0009084 glutamine family amino acid biosynthetic process
GO:0009555 pollen development
GO:0009793 embryo development ending in seed dormancy
GO:0016310 phosphorylation
GO:0055129 L-proline biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0009506 plasmodesma
GO:0009507 chloroplast

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8j0f, PDBe:8j0f, PDBj:8j0f
PDBsum8j0f
PubMed38740943
UniProtP54888|P5CS2_ARATH Delta-1-pyrroline-5-carboxylate synthase B (Gene Name=P5CSB)

[Back to BioLiP]