Structure of PDB 8ikd Chain B Binding Site BS02

Receptor Information
>8ikd Chain B (length=150) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MESIQPWIEKFIKQAQQQRSQSTKDYPTSYRNLRVKLSFGFGNFTSIPWF
AFLGEGQEASNGIYPVIYYYKDFDELVLAYGISDTNEPHAQWQFSDIPKT
IAEYFQATSGVYPKKYGQSYYACSQKVSQGIDYTRFASMLDNIINDYKLI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ikd Structural basis of target recognition by the DNA binding domain of McrBC
Resolution2.1 Å
Binding residue
(original residue number in PDB)
Q21 S22 T23 K24 F41 G42 N43
Binding residue
(residue number reindexed from 1)
Q21 S22 T23 K24 F41 G42 N43
Enzymatic activity
Enzyme Commision number 3.1.21.-
External links
PDB RCSB:8ikd, PDBe:8ikd, PDBj:8ikd
PDBsum8ikd
PubMed
UniProtP15005|MCRB_ECOLI Type IV methyl-directed restriction enzyme EcoKMcrB subunit (Gene Name=mcrB)

[Back to BioLiP]