Structure of PDB 8ik8 Chain B Binding Site BS02

Receptor Information
>8ik8 Chain B (length=150) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESIQPWIEKFIKQAQQQRSQSTKDYPTSYRNLRVKLSFGYGNFTSIPWFA
FLGEGQEASNGIYPVIFYYKDFDELVLAYGISDTNEPHAQWQFSDIPKTI
AEYFQATSGVYPKKYGQSYYACSQKVSQGIDYTRFASMLDNIINDYKLIF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ik8 Structural basis of target recognition by the DNA binding domain of McrBC
Resolution1.8 Å
Binding residue
(original residue number in PDB)
S38 G40 Y41 N43 T45 W49 A59 S60 Y64 S83 D84 T85 K116 Y117
Binding residue
(residue number reindexed from 1)
S37 G39 Y40 N42 T44 W48 A58 S59 Y63 S82 D83 T84 K114 Y115
Enzymatic activity
Enzyme Commision number 3.1.21.-
External links
PDB RCSB:8ik8, PDBe:8ik8, PDBj:8ik8
PDBsum8ik8
PubMed
UniProtP15005|MCRB_ECOLI Type IV methyl-directed restriction enzyme EcoKMcrB subunit (Gene Name=mcrB)

[Back to BioLiP]