Structure of PDB 8ij0 Chain B Binding Site BS02

Receptor Information
>8ij0 Chain B (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKI
QFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYH
LLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ij0 GAS41 promotes H2A.Z deposition through recognition of the N terminus of histone H3 by the YEATS domain.
Resolution1.52 Å
Binding residue
(original residue number in PDB)		S73 Y74 G92 W93 G94 E95 F96 F121
Binding residue
(residue number reindexed from 1)		S57 Y58 G76 W77 G78 E79 F80 F105
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:8ij0, PDBe:8ij0, PDBj:8ij0
PDBsum8ij0
PubMed37844223
UniProtO95619|YETS4_HUMAN YEATS domain-containing protein 4 (Gene Name=YEATS4)

[Back to BioLiP]