Structure of PDB 8ihm Chain B Binding Site BS02

Receptor Information
>8ihm Chain B (length=80) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVT
YTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Ligand information
>8ihm Chain J (length=159) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caggatgtatatatctgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccgggattctccagggcg
gccagtaag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ihm Structural basis for nucleosome binding and catalysis by the yeast Rpd3S/HDAC holoenzyme.
Resolution3.58 Å
Binding residue
(original residue number in PDB)
R35 S47 G48 K79 T80
Binding residue
(residue number reindexed from 1)
R14 S26 G27 K58 T59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8ihm, PDBe:8ihm, PDBj:8ihm
PDBsum8ihm
PubMed37845487
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]