Structure of PDB 8ifo Chain B Binding Site BS02

Receptor Information
>8ifo Chain B (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEIT
KRRRKSCQACRFMKCLKVGMLKEGVRLDRV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ifo ERR gamma-DBD undergoes dimerization and conformational rearrangement upon binding to the downstream site of the DR1 element
Resolution2.2 Å
Binding residue
(original residue number in PDB)		E146 A147 R154 R177 Q181 R184
Binding residue
(residue number reindexed from 1)		E23 A24 R31 R54 Q58 R61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8ifo, PDBe:8ifo, PDBj:8ifo
PDBsum8ifo
PubMed36944284
UniProtP62508|ERR3_HUMAN Estrogen-related receptor gamma (Gene Name=ESRRG)

[Back to BioLiP]