Structure of PDB 8hr1 Chain B Binding Site BS02

Receptor Information
>8hr1 Chain B (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRD
AVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Ligand information
>8hr1 Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctggagaatcccggtgccgaggccgctcaattggtcgtagacagctctag
caccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaagg
ggattactccctagtctccaggcacgtgtcagatatatacatcctgt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hr1 A Cryptic Basic Groove formed by Ubiquitin and Histone H3 Mediates Selective Recognition of H2AK119Ub Nucleosomes by Synovial Sarcoma X Breakpoint 1 Protein.
Resolution3.02 Å
Binding residue
(original residue number in PDB)		R19 T30 P32 R36 R45
Binding residue
(residue number reindexed from 1)		R1 T12 P14 R18 R27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:8hr1, PDBe:8hr1, PDBj:8hr1
PDBsum8hr1
PubMed38177667
UniProtP62805|H4_HUMAN Histone H4 (Gene Name=H4C1)

[Back to BioLiP]