Structure of PDB 8h0l Chain B Binding Site BS02

Receptor Information
>8h0l Chain B (length=146) Species: 286420 (Hahella ganghwensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSLLEYEAKFSELNPNRRHGNTSPHKIAMLLAVMDLIESGSLQENRIYFD
RQLKDAFTKRFNELKSEADRDNPHLPYYHLHTSGFWHHQVNPGQRESYKT
MSASGASAIDQHIAYAYLDEELFELLQNFTVRKLLTSALDRNFAIT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h0l Characterization of a promiscuous DNA sulfur binding domain and application in site-directed RNA base editing.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R17 R18 H19 S104 G105 A106 S107
Binding residue
(residue number reindexed from 1)		R17 R18 H19 S104 G105 A106 S107
External links