Structure of PDB 8g9o Chain B Binding Site BS02

Receptor Information
>8g9o Chain B (length=186) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ISLEQIDGFAAKSFPLCMRQLHKSLRENHHLRHGGRMQYGLFLKGIGLTL
EQALQFWRLEFTKGKVDSEKFDKVYAYSIRHNYGKEGKRTDYTPYSCMKV
ILSNPPSQGDYHGCPFRHSDPELLKQKLQSFKVPSSGINQILELVKGMHY
QLACQKYFELTHSVDDCGFSLNHPNQYFAESQKLLT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g9o A mechanistic model of primer synthesis from catalytic structures of DNA polymerase alpha-primase.
Resolution4.4 Å
Binding residue
(original residue number in PDB)		H306 R308 H309 R312
Binding residue
(residue number reindexed from 1)		H30 R32 H33 R36
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006269 DNA replication, synthesis of primer
GO:0006270 DNA replication initiation
Cellular Component
GO:0005658 alpha DNA polymerase:primase complex
GO:1990077 primosome complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8g9o, PDBe:8g9o, PDBj:8g9o
PDBsum8g9o
PubMed38491139
UniProtA0A1L8G3G3

[Back to BioLiP]