Structure of PDB 8f17 Chain B Binding Site BS02

Receptor Information
>8f17 Chain B (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKM
QQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSL
AKEQRLNFGDDIPSALRIAKKKRWNSIEE
Ligand information
>8f17 Chain D (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PLDLCYWASLHCIVS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8f17 Single-Shot Flow Synthesis of D-Proteins for Mirror-Image Phage Display
Resolution2.21 Å
Binding residue
(original residue number in PDB)		N34 F37 L68 K72 V94 K95 F98 Q102 D134 A138 I141
Binding residue
(residue number reindexed from 1)		N11 F14 L45 K49 V71 K72 F75 Q79 D111 A115 I118
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:8f17, PDBe:8f17, PDBj:8f17
PDBsum8f17
PubMed
UniProtQ9UNE7|CHIP_HUMAN E3 ubiquitin-protein ligase CHIP (Gene Name=STUB1)

[Back to BioLiP]