Structure of PDB 8eml Chain B Binding Site BS02

Receptor Information
>8eml Chain B (length=57) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNR
RVKHKKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eml Crystal Structure of Gsx2 Homeodomain in Complex with DNA
Resolution2.21 Å
Binding residue
(original residue number in PDB)		R205 R207 T208 F210 N253
Binding residue
(residue number reindexed from 1)		R1 R3 T4 F6 N49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8eml, PDBe:8eml, PDBj:8eml
PDBsum8eml
PubMed
UniProtP31316|GSX2_MOUSE GS homeobox 2 (Gene Name=Gsx2)

[Back to BioLiP]