Structure of PDB 8ejo Chain B Binding Site BS02

Receptor Information

>8ejo Chain B (length=56) Species: 9258 (Ornithorhynchus anatinus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ARRKRTTFNKTQLEILVKSFNKDPYPGIGVREHLASLIQIPESRIQVWFQ
NRRARQ

Ligand information

>8ejo Chain D (length=17) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgttgattagattacgc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ejo Antagonism among DUX family members evolved from an ancestral toxic single homeodomain protein.
Resolution	2.67 Å
Binding residue (original residue number in PDB)	R22 R23 R25 T26 F28 W68 N71 R75
Binding residue (residue number reindexed from 1)	R2 R3 R5 T6 F8 W48 N51 R55

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:8ejo, PDBe:8ejo, PDBj:8ejo
PDBsum	8ejo
PubMed	37744032
UniProt	A0A6I8NF41

[Back to BioLiP]