Structure of PDB 8d96 Chain B Binding Site BS02

Receptor Information
>8d96 Chain B (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KISLDQIDLLSTKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLT
LEQALQFWKQEFIKGKMDPDKFDKGYSYNIRHSFGKEGKRTDYTPFSCLK
IILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTH
YQVACQKYFEMIHNVDDCGFSLNHPNQFFCESQRILN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8d96 Structures of human primosome elongation complexes.
Resolution3.35 Å
Binding residue
(original residue number in PDB)
M307 Y347 N348 H351 G357 K358 T360 D361 Y362 T363 F365 N445
Binding residue
(residue number reindexed from 1)
M38 Y78 N79 H82 G88 K89 T91 D92 Y93 T94 F96 N176
Enzymatic activity
Enzyme Commision number 2.7.7.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
GO:0071667 DNA/RNA hybrid binding
Biological Process
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006269 DNA replication, synthesis of primer
GO:0006270 DNA replication initiation
GO:1903934 positive regulation of DNA primase activity
Cellular Component
GO:0005654 nucleoplasm
GO:0005658 alpha DNA polymerase:primase complex
GO:1990077 primosome complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8d96, PDBe:8d96, PDBj:8d96
PDBsum8d96
PubMed37069376
UniProtP49643|PRI2_HUMAN DNA primase large subunit (Gene Name=PRIM2)

[Back to BioLiP]