Structure of PDB 8cyf Chain B Binding Site BS02

Receptor Information
>8cyf Chain B (length=89) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVSFTLLQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVT
RERIRQIESKTMSKLRHPSRSQVLRDGTPEERLLRAIFG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cyf Structural basis of DNA binding by the WhiB-like transcription factor WhiB3 in Mycobacterium tuberculosis.
Resolution2.44 Å
Binding residue
(original residue number in PDB)		R470 V498 T499 R502 Q505
Binding residue
(residue number reindexed from 1)		R21 V49 T50 R53 Q56
Enzymatic activity
Enzyme Commision number 2.7.7.6: DNA-directed RNA polymerase.
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8cyf, PDBe:8cyf, PDBj:8cyf
PDBsum8cyf
PubMed37142222
UniProtP9WGI1|SIGA_MYCTU RNA polymerase sigma factor SigA (Gene Name=sigA);
P9WGY9|RPOB_MYCTU DNA-directed RNA polymerase subunit beta (Gene Name=rpoB)

[Back to BioLiP]