Structure of PDB 8csq Chain B Binding Site BS02

Receptor Information

>8csq Chain B (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

STDFNDKILNEPLKHSDFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEP
YIFGSRLDHDIIDLEQTATHLQLALNFTAHMAYRKGIILFISRNRQFSYL
IENMARDCGEYAHTRYFRGGMLTNARLLFGPTVRLPDLIIFLHTLNNIFE
PHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQ
TAITRAKEKRQQVEALYRLQ

Ligand information

>8csq Chain Q (length=6) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DPWQGC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8csq Principles of mitoribosomal small subunit assembly in eukaryotes.
Resolution	2.54 Å
Binding residue (original residue number in PDB)	R149 Q150
Binding residue (residue number reindexed from 1)	R95 Q96

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation
GO:0061668	mitochondrial ribosome assembly

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005759	mitochondrial matrix
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8csq, PDBe:8csq, PDBj:8csq
PDBsum	8csq
PubMed	36482135
UniProt	Q9Y399\|RT02_HUMAN Small ribosomal subunit protein uS2m (Gene Name=MRPS2)

[Back to BioLiP]