Structure of PDB 8c84 Chain B Binding Site BS02

Receptor Information
>8c84 Chain B (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHS
NKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKGFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8c84 Structural basis of myocyte enhancer factor-2 recruitment of class II histone deacetylases.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
G2 R3 K5 K31
Binding residue
(residue number reindexed from 1)
G1 R2 K4 K30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8c84, PDBe:8c84, PDBj:8c84
PDBsum8c84
PubMed38492719
UniProtQ14814|MEF2D_HUMAN Myocyte-specific enhancer factor 2D (Gene Name=MEF2D)

[Back to BioLiP]