Structure of PDB 8byx Chain B Binding Site BS02

Receptor Information
>8byx Chain B (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQ
NRRVKEKKVLAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8byx HOXB13-homodimer bound to DNA
Resolution3.0 Å
Binding residue
(original residue number in PDB)
R220 F240 R246 Q265 R268
Binding residue
(residue number reindexed from 1)
R5 F25 R31 Q50 R53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8byx, PDBe:8byx, PDBj:8byx
PDBsum8byx
PubMed
UniProtQ92826|HXB13_HUMAN Homeobox protein Hox-B13 (Gene Name=HOXB13)

[Back to BioLiP]