Structure of PDB 8btg Chain B Binding Site BS02

Receptor Information
>8btg Chain B (length=335) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKT
HLMHAIGHYVIDHNPSAKVVYLSSEKFTNEFINSIRDNKAVDFRNRYRNV
DVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLE
DRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIPNEVMLYIANQI
DSNIRELEGALIRVVAYSSLINKDINADLAAEALKDISKPKVITIKEIQR
VVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTDSSLPKIGEEFGG
RDHTTVIHAHEKISKLLADDEQLQQHVKEIKEQLK
Ligand information
>8btg Chain Y (length=41) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tagtagaagtaatagtagggcctgtggatttgtggataagt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8btg The bacterial replication origin BUS promotes nucleobase capture.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
N187 F189 I190 I193 R202 F218 K222 E223 Q224 E228 S401 L402 P403 H414 T415 I418
Binding residue
(residue number reindexed from 1)
N79 F81 I82 I85 R94 F110 K114 E115 Q116 E120 S290 L291 P292 H303 T304 I307
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003688 DNA replication origin binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
GO:0042802 identical protein binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006260 DNA replication
GO:0006270 DNA replication initiation
GO:0006275 regulation of DNA replication
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:1990101 DnaA-oriC complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8btg, PDBe:8btg, PDBj:8btg
PDBsum8btg
PubMed38097584
UniProtP05648|DNAA_BACSU Chromosomal replication initiator protein DnaA (Gene Name=dnaA)

[Back to BioLiP]