Structure of PDB 8bah Chain B Binding Site BS02

Receptor Information
>8bah Chain B (length=398) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TADALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEV
DFILLGGDLFHENKPSRKTLHTCLELLRKYCMGDRPVQFEILSDQSVNFG
FSKFPWVNYQDGNLNISIPVFSIHGNNDDPTGADALCALDILSCAGFVNH
FGRSMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLR
PKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIA
PTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIPLH
TVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERL
GNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFR
Ligand information
Ligand IDMN
InChIInChI=1S/Mn/q+2
InChIKeyWAEMQWOKJMHJLA-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mn+2]
CACTVS 3.341[Mn++]
FormulaMn
NameMANGANESE (II) ION
ChEMBL
DrugBankDB06757
ZINC
PDB chain8bah Chain B Residue 802 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bah Cryo-EM structure of the Mre11-Rad50-Nbs1 complex reveals the molecular mechanism of scaffolding functions.
Resolution4.13 Å
Binding residue
(original residue number in PDB)		D60 N128 H217 H245
Binding residue
(residue number reindexed from 1)		D58 N126 H215 H243
Annotation score4
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000014 single-stranded DNA endodeoxyribonuclease activity
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0003690 double-stranded DNA binding
GO:0004518 nuclease activity
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
GO:0004527 exonuclease activity
GO:0005515 protein binding
GO:0008296 3'-5'-DNA exonuclease activity
GO:0008408 3'-5' exonuclease activity
GO:0016787 hydrolase activity
GO:0030145 manganese ion binding
GO:0042802 identical protein binding
GO:0045296 cadherin binding
Biological Process
GO:0000019 regulation of mitotic recombination
GO:0000723 telomere maintenance
GO:0000724 double-strand break repair via homologous recombination
GO:0000729 DNA double-strand break processing
GO:0006281 DNA repair
GO:0006302 double-strand break repair
GO:0006303 double-strand break repair via nonhomologous end joining
GO:0006310 DNA recombination
GO:0006974 DNA damage response
GO:0007004 telomere maintenance via telomerase
GO:0007062 sister chromatid cohesion
GO:0007095 mitotic G2 DNA damage checkpoint signaling
GO:0007129 homologous chromosome pairing at meiosis
GO:0007131 reciprocal meiotic recombination
GO:0008283 cell population proliferation
GO:0031573 mitotic intra-S DNA damage checkpoint signaling
GO:0031860 telomeric 3' overhang formation
GO:0031954 positive regulation of protein autophosphorylation
GO:0032206 positive regulation of telomere maintenance
GO:0032508 DNA duplex unwinding
GO:0033674 positive regulation of kinase activity
GO:0035825 homologous recombination
GO:0042138 meiotic DNA double-strand break formation
GO:0043066 negative regulation of apoptotic process
GO:0044818 mitotic G2/M transition checkpoint
GO:0051276 chromosome organization
GO:0051321 meiotic cell cycle
GO:0062176 R-loop processing
GO:0097552 mitochondrial double-strand break repair via homologous recombination
GO:0110025 DNA strand resection involved in replication fork processing
GO:2001033 negative regulation of double-strand break repair via nonhomologous end joining
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005657 replication fork
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016605 PML body
GO:0030870 Mre11 complex
GO:0035861 site of double-strand break
GO:0070533 BRCA1-C complex
GO:0098687 chromosomal region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bah, PDBe:8bah, PDBj:8bah
PDBsum8bah
PubMed36577401
UniProtP49959|MRE11_HUMAN Double-strand break repair protein MRE11 (Gene Name=MRE11)

[Back to BioLiP]