Structure of PDB 8b87 Chain B Binding Site BS02

Receptor Information
>8b87 Chain B (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RIEEEELTLTILRQTGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAAR
AGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b87 Crystal structure of Scribble PDZ1 with human papillomavirus strain 16 E6 peptide
Resolution2.0 Å
Binding residue
(original residue number in PDB)		L738 I740 S741 I742 A743 S748 T749 E756 S761 R762 H793 V797 L800 R801
Binding residue
(residue number reindexed from 1)		L17 I19 S20 I21 A22 S27 T28 E35 S40 R41 H72 V76 L79 R80
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8b87, PDBe:8b87, PDBj:8b87
PDBsum8b87
PubMed
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]