Structure of PDB 8anv Chain B Binding Site BS02

Receptor Information
>8anv Chain B (length=67) Species: 10736 (Bacillus phage phi3T) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTNNKYYTEENKKKVWKKHMIVLKFLEQPGISEAYLNYLQEEIHNDEWIG
FENEFFEELTGKPVINV
Ligand information
>8anv Chain F (length=13) Species: 10736 (Bacillus phage phi3T) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SYEEMAKGYEEMA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8anv Antagonistic interactions between phage and host factors control arbitrium lysis-lysogeny decision
Resolution2.2 Å
Binding residue
(original residue number in PDB)		N4 K5 Y6 Y7 W48 F51
Binding residue
(residue number reindexed from 1)		N4 K5 Y6 Y7 W48 F51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:8anv, PDBe:8anv, PDBj:8anv
PDBsum8anv
PubMed38177302
UniProtA0A1P8CWW1

[Back to BioLiP]