Structure of PDB 8amf Chain B Binding Site BS02

Receptor Information
>8amf Chain B (length=333) Species: 1313 (Streptococcus pneumoniae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEISKKFGAEREKALNDALKLIEKDFGKGSIMRLGERAEQKVQVMSSGSL
ALDIALGSGGYPKGRIIEIYGPESSGKTTVALHAVAQAQKEGGIAAFIDA
EHALDPAYAAALGVNIDELLLSQPDSGEQGLEIAGKLIDSGAVDLVVVDS
VAALVPRAEIDGDIGDSHVGLQARMMSQAMRKLGASINKTKTIAIFINQL
REKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKETNVGKE
TKIKVVKNKVAPPFKEAVVEIMYGEGISKTGELLKIASDLDIIKKAGAWY
SYKDEKIGQGSENAKKYLAEHPEIFDEIDKQVR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8amf Assembly mechanism and cryoEM structure of RecA filaments from Streptococcus pneumoniae
Resolution3.8 Å
Binding residue
(original residue number in PDB)		G178 A181 R182 S185 E210 V212 G225
Binding residue
(residue number reindexed from 1)		G170 A173 R174 S177 E202 V204 G217
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003697 single-stranded DNA binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0009432 SOS response
GO:0030420 establishment of competence for transformation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8amf, PDBe:8amf, PDBj:8amf
PDBsum8amf
PubMed36806960
UniProtP0A452|RECA_STRR6 Protein RecA (Gene Name=recA)

[Back to BioLiP]