Structure of PDB 8aag Chain B Binding Site BS02

Receptor Information
>8aag Chain B (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>8aag Chain J (length=185) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
taatattggccagctaggatatcacaatcccggtgccgaggccgctcaat
tggtcgtagacagctctagcaccgcttaaacgcacgtacggattccgtac
gtgcgtttaagcggtgctagagctgtctacgaccaattgagcggcctcgg
caccgggattgtgatatcctagctggccaatatta
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8aag Nucleosome dyad determines the H1 C-terminus collapse on distinct DNA arms.
Resolution10.0 Å
Binding residue
(original residue number in PDB)
R35 I46 S47 G48 K79 T80
Binding residue
(residue number reindexed from 1)
R16 I27 S28 G29 K60 T61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0032200 telomere organization
GO:0045653 negative regulation of megakaryocyte differentiation
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0043505 CENP-A containing nucleosome
GO:0070062 extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8aag, PDBe:8aag, PDBj:8aag
PDBsum8aag
PubMed36610392
UniProtP62805|H4_HUMAN Histone H4 (Gene Name=H4C1)

[Back to BioLiP]