Structure of PDB 8a0x Chain B Binding Site BS02

Receptor Information
>8a0x Chain B (length=103) Species: 666 (Vibrio cholerae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNRDLFAELSSALVEAKQHSEGKLTLKTHHVNDVGELNISPDEIVSIREQ
FNMSRGVFARLLHTSSRTLENWEQGRSVPNGQAVTLLKLVQRHPETLSHI
AEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a0x Fuzzy DNA recognition by a prokaryotic transcription factor
Resolution3.296 Å
Binding residue
(original residue number in PDB)		S66 R68 T69 N72 W73 S78 V79 N81
Binding residue
(residue number reindexed from 1)		S65 R67 T68 N71 W72 S77 V78 N80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a0x, PDBe:8a0x, PDBj:8a0x
PDBsum8a0x
PubMed
UniProtQ9KMA5|HIGA2_VIBCH Antitoxin HigA-2 (Gene Name=higA-2)

[Back to BioLiP]