Structure of PDB 8a0w Chain B Binding Site BS02

Receptor Information
>8a0w Chain B (length=68) Species: 666 (Vibrio cholerae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVPNGQAVT
LLKLVQRHPETLSHIAEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a0w Fuzzy DNA recognition by a prokaryotic transcription factor
Resolution2.334 Å
Binding residue
(original residue number in PDB)		S66 R68 T69 N72 W73 S78 N81
Binding residue
(residue number reindexed from 1)		S30 R32 T33 N36 W37 S42 N45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a0w, PDBe:8a0w, PDBj:8a0w
PDBsum8a0w
PubMed38600130
UniProtQ9KMA5|HIGA2_VIBCH Antitoxin HigA-2 (Gene Name=higA-2)

[Back to BioLiP]