Structure of PDB 7yun Chain B Binding Site BS02

Receptor Information
>7yun Chain B (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FQIEKWQIARCNKSKPQKFINDLMQVLYTNEYMATHSLTGAKSSTSRDKA
VKPAMNQNEVQEIIGVTKQLFPNTDDVSIRRMIGQKLNNCTK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yun Structural insights into DNA recognition by the BEN domain of the transcription factor BANP.
Resolution2.13 Å
Binding residue
(original residue number in PDB)		Q190 N194 S217 Q258 N262
Binding residue
(residue number reindexed from 1)		Q17 N21 S44 Q85 N89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003714 transcription corepressor activity
Biological Process
GO:0045666 positive regulation of neuron differentiation
GO:0045746 negative regulation of Notch signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7yun, PDBe:7yun, PDBj:7yun
PDBsum7yun
PubMed37086783
UniProtQ5SZJ8|BEND6_HUMAN BEN domain-containing protein 6 (Gene Name=BEND6)

[Back to BioLiP]