Structure of PDB 7y3m Chain B Binding Site BS02

Receptor Information
>7y3m Chain B (length=55) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HKCKYCSKVFGTDSSLQIHLRSHTGERPFVCSVCGHRFTTKGNLKVHFHR
HPQVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y3m Structural studies of SALL family protein zinc finger cluster domains in complex with DNA reveal preferential binding to an AATA tetranucleotide motif.
Resolution2.723 Å
Binding residue
(original residue number in PDB)		T393 S395 K422 K426
Binding residue
(residue number reindexed from 1)		T12 S14 K41 K45
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7y3m, PDBe:7y3m, PDBj:7y3m
PDBsum7y3m
PubMed36257403
UniProtQ9UJQ4|SALL4_HUMAN Sal-like protein 4 (Gene Name=SALL4)

[Back to BioLiP]