Structure of PDB 7y3k Chain B Binding Site BS02

Receptor Information
>7y3k Chain B (length=54) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQHGCTRCGKNFSSASALQIHERTHTGEKPFVCNICGRAFTTKGNLKVHY
MTHG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y3k Structural studies of SALL family protein zinc finger cluster domains in complex with DNA reveal preferential binding to an AATA tetranucleotide motif.
Resolution2.501 Å
Binding residue
(original residue number in PDB)		S883 K914
Binding residue
(residue number reindexed from 1)		S16 K47
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7y3k, PDBe:7y3k, PDBj:7y3k
PDBsum7y3k
PubMed36257403
UniProtQ9UJQ4|SALL4_HUMAN Sal-like protein 4 (Gene Name=SALL4)

[Back to BioLiP]