Structure of PDB 7y3i Chain B Binding Site BS02

Receptor Information
>7y3i Chain B (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QHGCTRCGKNFSSASALQIHERTHTGEKPFVCNICGRAFTTKGNLKVHYM
THG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y3i Structural studies of SALL family protein zinc finger cluster domains in complex with DNA reveal preferential binding to an AATA tetranucleotide motif.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		H888 T891 R905 N912 H916 T919
Binding residue
(residue number reindexed from 1)		H20 T23 R37 N44 H48 T51
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7y3i, PDBe:7y3i, PDBj:7y3i
PDBsum7y3i
PubMed36257403
UniProtQ9UJQ4|SALL4_HUMAN Sal-like protein 4 (Gene Name=SALL4)

[Back to BioLiP]