Structure of PDB 7xq5 Chain B Binding Site BS02

Receptor Information
>7xq5 Chain B (length=73) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDPVKVRKWKHVQMEKIRRINTKEAFERLIKSVRTPPKENGKRIPKHILL
TCVMNDIKSIRSANEALQHILDD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xq5 Structural Analysis of Ino2p/Ino4p Mutual Interactions and Their Binding Interface with Promoter DNA.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		H12 V13 E16 K17 R20 K24 R44 P46 K47 H48
Binding residue
(residue number reindexed from 1)		H11 V12 E15 K16 R19 K23 R43 P45 K46 H47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:7xq5, PDBe:7xq5, PDBj:7xq5
PDBsum7xq5
PubMed35886947
UniProtP26798|INO2_YEAST Protein INO2 (Gene Name=INO2)

[Back to BioLiP]