Structure of PDB 7xjg Chain B Binding Site BS02

Receptor Information
>7xjg Chain B (length=314) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAEYLNTFRLRNLGLPVMNNLHDMSKATRISVETLRLLIYTADFRYRIYT
VEKKGPEKRMRTIYQPSRELKALQGWVLRNILDKLSSSPFSIGFEKHQSI
LNNATPHIGANFILNIDLEDFFPSLTANKVFGVFHSLGYNRLISSVLTKI
CCYKNLLPQGAPSSPKLANLICSKLDYRIQGYAGSRGLIYTRYADDLTLS
AQSMKKVVKARDFLFSIIPSEGLVINSKKTCISGPRSQRKVTGLVISQEK
VGIGREKYKEIRAKIHHIFCGKSSEIEHVRGWLSFILSVDSKSHRRLITY
ISKLEKKYGKNPLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xjg Cryo-EM structures of Escherichia coli Ec86 retron complexes reveal architecture and defence mechanism.
Resolution2.51 Å
Binding residue
(original residue number in PDB)		E35 R38 L39 Y42 F46 R49 Y51 P68 R70 K73 A129 K131 F133 R143 S147 T150 K176 R180 G183 Y184 R188 Y195 D197 D198 K211 D214 F215 H280 G283 W284 F287
Binding residue
(residue number reindexed from 1)		E33 R36 L37 Y40 F44 R47 Y49 P66 R68 K71 A127 K129 F131 R141 S145 T148 K174 R178 G181 Y182 R186 Y193 D195 D196 K209 D212 F213 H278 G281 W282 F285
Enzymatic activity
Enzyme Commision number 2.7.7.49: RNA-directed DNA polymerase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003964 RNA-directed DNA polymerase activity
GO:0046872 metal ion binding
Biological Process
GO:0006278 RNA-templated DNA biosynthetic process
GO:0006974 DNA damage response
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7xjg, PDBe:7xjg, PDBj:7xjg
PDBsum7xjg
PubMed35982312
UniProtP23070|RT86_ECOLX Retron Ec86 reverse transcriptase (Gene Name=ret)

[Back to BioLiP]