Structure of PDB 7x5g Chain B Binding Site BS02

Receptor Information
>7x5g Chain B (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRR
RGKNKVYAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLL
KKQLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7x5g Structural basis of transcription regulation by CNC family transcription factor, Nrf2.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R499 R502 N507 Y510 C514 K518
Binding residue
(residue number reindexed from 1)		R46 R49 N54 Y57 C61 K65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7x5g, PDBe:7x5g, PDBj:7x5g
PDBsum7x5g
PubMed36454022
UniProtQ16236|NF2L2_HUMAN Nuclear factor erythroid 2-related factor 2 (Gene Name=NFE2L2)

[Back to BioLiP]