Structure of PDB 7wb3 Chain B Binding Site BS02

Receptor Information
>7wb3 Chain B (length=203) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPKPVSKRLVSYYMCLERLLDEGVEVVSSEELARRLDLKASQIRKDLSYF
GEFGKRGVGYNVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMK
EKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSELEKFVEEHGVEIGVIAVP
AEHAQEIAERLEKAGIKGILNFAPVKIKVSVPVENIDITASLRVLTFEIV
RRN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wb3 Structural Basis of Redox-Sensing Transcriptional Repressor Rex with Cofactor NAD + and Operator DNA.
Resolution2.401 Å
Binding residue
(original residue number in PDB)		S32 S33 R48 K49 E56 G58 R60 G61 V62 G63 Y64
Binding residue
(residue number reindexed from 1)		S28 S29 R44 K45 E52 G54 R56 G57 V58 G59 Y60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0051775 response to redox state
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wb3, PDBe:7wb3, PDBj:7wb3
PDBsum7wb3
PubMed35163512
UniProtQ9WY16|REX1_THEMA Redox-sensing transcriptional repressor Rex 1 (Gene Name=rex1)

[Back to BioLiP]