Structure of PDB 7vup Chain B Binding Site BS02

Receptor Information
>7vup Chain B (length=296) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKIC
NYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQF
NNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKK
VMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRM
DKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHK
QYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vup Structures of NF-kappa B p52 homodimer-DNA complexes rationalize binding mechanisms and transcription activation.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		Y55 C57 H62 T142 K143 K221 P223 Q284
Binding residue
(residue number reindexed from 1)		Y22 C24 H29 T109 K110 K188 P190 Q251
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vup, PDBe:7vup, PDBj:7vup
PDBsum7vup
PubMed36779700
UniProtQ00653|NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit (Gene Name=NFKB2)

[Back to BioLiP]