Structure of PDB 7vjm Chain B Binding Site BS02

Receptor Information
>7vjm Chain B (length=72) Species: 1223260 (Pseudomonas phage JBD30) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTPDASNHDPDPRYLRGLLKKAGISQRRAAELLGLSDRVMRYYLSEDIKE
GYRPAPYTVQFALECLANDPPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vjm Structural basis for anti-CRISPR repression mediated by bacterial operon proteins Aca1 and Aca2.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		S42 V45 Y48 Y49 R59
Binding residue
(residue number reindexed from 1)		S36 V39 Y42 Y43 R53
Enzymatic activity
Enzyme Commision number ?
External links