Structure of PDB 7tjh Chain B Binding Site BS02

Receptor Information
>7tjh Chain B (length=251) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SASSFLDTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNEN
FQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYL
SPKIAYSQLNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYW
GNHVILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSV
IRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDISNFEPSTVESTFQDVM
K
Ligand information
>7tjh Chain H (length=41) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tttgaaaagcaagcataaaagatctaaacataaaatctgta
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tjh A mechanism of origin licensing control through autoinhibition of S. cerevisiae ORC·DNA·Cdc6.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
K251 R373 R390 W396 H399
Binding residue
(residue number reindexed from 1)
K17 R127 R144 W150 H153
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0003688 DNA replication origin binding
GO:0005515 protein binding
Biological Process
GO:0006260 DNA replication
GO:0006267 pre-replicative complex assembly involved in nuclear cell cycle DNA replication
GO:0006270 DNA replication initiation
GO:0030466 silent mating-type cassette heterochromatin formation
GO:0031509 subtelomeric heterochromatin formation
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000808 origin recognition complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005656 nuclear pre-replicative complex
GO:0005664 nuclear origin of replication recognition complex
GO:0031261 DNA replication preinitiation complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7tjh, PDBe:7tjh, PDBj:7tjh
PDBsum7tjh
PubMed35217664
UniProtP32833|ORC2_YEAST Origin recognition complex subunit 2 (Gene Name=ORC2)

[Back to BioLiP]