Structure of PDB 7t1l Chain B Binding Site BS02

Receptor Information
>7t1l Chain B (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKPLHEQLWYHGAIPRAEVAELLVHSGDFLVRESETVKGAYALSVLWDGL
PRHFLIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKKSGVVLHRAVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7t1l Engineered SH2 Domains for Targeted Phosphoproteomics.
Resolution1.35 Å
Binding residue
(original residue number in PDB)		R16 R32 S34 E35 T36 R52 H53 F54 L55 Q57
Binding residue
(residue number reindexed from 1)		R16 R32 S34 E35 T36 R52 H53 F54 L55 Q57
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:7t1l, PDBe:7t1l, PDBj:7t1l
PDBsum7t1l
PubMed35613471
UniProtP07332|FES_HUMAN Tyrosine-protein kinase Fes/Fps (Gene Name=FES)

[Back to BioLiP]