Structure of PDB 7r97 Chain B Binding Site BS02

Receptor Information
>7r97 Chain B (length=226) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNARLEFLGDSILSY
VIANALYHRFPRVDAGDMSRMRATLVRGNTLAELAREFELGECLRLGPGE
LKSGGFRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTRLDEISPG
DKQKDPKTRLQEYLAGRHLPLPTYLVVQVRGEAHDQEFTIHCQVSGLSEP
VVGTGSSRRKAEQAAAEQALKKLELE
Ligand information
>7r97 Chain D (length=28) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaaggucauucgcaagaguggccuuuau
<<<<<<<<<<<....>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r97 Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
Resolution1.804 Å
Binding residue
(original residue number in PDB)		H29 R30 S31 D45 G99 E100 K102 R108 S110 E117 A183 H184 Q186 R208 R209
Binding residue
(residue number reindexed from 1)		H29 R30 S31 D45 G99 E100 K102 R108 S110 E117 A183 H184 Q186 R208 R209
Enzymatic activity
Enzyme Commision number 3.1.26.3: ribonuclease III.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0004525 ribonuclease III activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0019843 rRNA binding
GO:0019899 enzyme binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008033 tRNA processing
GO:0010468 regulation of gene expression
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r97, PDBe:7r97, PDBj:7r97
PDBsum7r97
PubMed35829618
UniProtP0A7Y0|RNC_ECOLI Ribonuclease 3 (Gene Name=rnc)

[Back to BioLiP]