Structure of PDB 7qr3 Chain B Binding Site BS02

Receptor Information
>7qr3 Chain B (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAF
VIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Ligand information
>7qr3 Chain D (length=69) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggggccacagcagaagcguucacgucgcggccccugucagccauugcac
uccggcugcgaauucugcu
<<<<<<<..((((((.<<<.......>>>>>>>>>>..<<<<<.......
...>>>>>.....))))))
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qr3 Anticodon-like loop-mediated dimerization in the crystal structures of HdV-like CPEB3 ribozymes
Resolution2.18 Å
Binding residue
(original residue number in PDB)		N12 K14 D73
Binding residue
(residue number reindexed from 1)		N12 K14 D73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7qr3, PDBe:7qr3, PDBj:7qr3
PDBsum7qr3
PubMed
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]