Structure of PDB 7qfw Chain B Binding Site BS02

Receptor Information
>7qfw Chain B (length=94) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FEKDLMAYFDENLNRNWRGREHWKVRNVLEIDFFKTDDSFEDKVFASKGR
TKIDMPIKNRKNDTHYLLPDDFHFSTDRITRLFIKPAQKMSLFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qfw A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
Resolution3.86 Å
Binding residue
(original residue number in PDB)		R400 R411 R480
Binding residue
(residue number reindexed from 1)		R15 R26 R50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0005515 protein binding
Biological Process
GO:0000070 mitotic sister chromatid segregation
GO:0007076 mitotic chromosome condensation
GO:0030261 chromosome condensation
GO:0051301 cell division
GO:0070058 tRNA gene clustering
Cellular Component
GO:0000796 condensin complex
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qfw, PDBe:7qfw, PDBj:7qfw
PDBsum7qfw
PubMed35653469
UniProtP38170|CND2_YEAST Condensin complex subunit 2 (Gene Name=BRN1)

[Back to BioLiP]