Structure of PDB 7pzb Chain B Binding Site BS02

Receptor Information

>7pzb Chain B (length=226) Species: 266834 (Sinorhizobium meliloti 1021) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RSSAFWRSFPIFEEFDSETLCELSGIASYRKWSAGTVIFQRGDQGDYMIV
VVSGRIKLSLFTPQGRELMLRQHEAGALFGEMALLDGQPRSADATAVTAA
EGYVIGKKDFLALITQRPKTAEAVIRFLCAQLRDTTDRLETIALYDLNAR
VARFFLATLRQIHGSEMPQSANLRLTLSQTDIASILGASRPKVNRAILSL
EESGAIKRADGIICCNVGRLLSIADP

Ligand information

>7pzb Chain F (length=10) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtaatgttac

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7pzb Structural Basis of Dual Specificity of Sinorhizobium meliloti Clr, a cAMP and cGMP Receptor Protein.
Resolution	3.12 Å
Binding residue (original residue number in PDB)	S183 Q184 P196 N199 L203 R213
Binding residue (residue number reindexed from 1)	S178 Q179 P191 N194 L198 R208

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0046872	metal ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pzb, PDBe:7pzb, PDBj:7pzb
PDBsum	7pzb
PubMed	37017526
UniProt	Q92SD2

[Back to BioLiP]