Structure of PDB 7p0u Chain B Binding Site BS02

Receptor Information
>7p0u Chain B (length=132) Species: 10258 (Orf virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQEL
SNAEHPENSHIPAALVSALLEPTSPGRMVTAVELCAQMGRLWTRGRQLVD
FMRLVYVLLDRLPPTADEDLGAWLQAVARVHG
Ligand information
>7p0u Chain C (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SAAQLTAARLKALGDELHQRTMWR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p0u Structural Investigation of Orf Virus Bcl-2 Homolog ORFV125 Interactions with BH3-Motifs from BH3-Only Proteins Puma and Hrk.
Resolution1.99374 Å
Binding residue
(original residue number in PDB)		V47 P50 E54 A58 A77 L78 P85 G86 R87 W133 A136 R139 V140
Binding residue
(residue number reindexed from 1)		V42 P45 E49 A53 A68 L69 P75 G76 R77 W123 A126 R129 V130
Enzymatic activity
Enzyme Commision number ?
External links