Structure of PDB 7olg Chain B Binding Site BS02

Receptor Information
>7olg Chain B (length=70) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEAAELMQQVKVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQ
RIVDILYATDEGFVIPDEGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7olg EB1 bound to MACF peptide
ResolutionN/A
Binding residue
(original residue number in PDB)		E225 L226 Q229 L246 T249 F253 V254 I255 P256 D257 G260
Binding residue
(residue number reindexed from 1)		E35 L36 Q39 L56 T59 F63 V64 I65 P66 D67 G70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008017 microtubule binding

View graph for
Molecular Function
External links
PDB RCSB:7olg, PDBe:7olg, PDBj:7olg
PDBsum7olg
PubMed
UniProtQ61166|MARE1_MOUSE Microtubule-associated protein RP/EB family member 1 (Gene Name=Mapre1)

[Back to BioLiP]