Structure of PDB 7m5n Chain B Binding Site BS02

Receptor Information
>7m5n Chain B (length=253) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLT
LRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLAL
VFEAPNQEKVSDYEMKLMDLVEQLGIPEQEYSCVVKMPSGEFARICRDLS
HIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEP
VQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLA
PKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7m5n A cell permeable bimane-constrained PCNA-interacting peptide.
Resolution3.11 Å
Binding residue
(original residue number in PDB)		N24 N71
Binding residue
(residue number reindexed from 1)		N23 N70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000701 purine-specific mismatch base pair DNA N-glycosylase activity
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003684 damaged DNA binding
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0030331 nuclear estrogen receptor binding
GO:0030337 DNA polymerase processivity factor activity
GO:0030971 receptor tyrosine kinase binding
GO:0032139 dinucleotide insertion or deletion binding
GO:0032405 MutLalpha complex binding
GO:0035035 histone acetyltransferase binding
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
GO:0070182 DNA polymerase binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006260 DNA replication
GO:0006272 leading strand elongation
GO:0006275 regulation of DNA replication
GO:0006281 DNA repair
GO:0006287 base-excision repair, gap-filling
GO:0006298 mismatch repair
GO:0006979 response to oxidative stress
GO:0007507 heart development
GO:0019985 translesion synthesis
GO:0030855 epithelial cell differentiation
GO:0031297 replication fork processing
GO:0032077 positive regulation of deoxyribonuclease activity
GO:0032355 response to estradiol
GO:0033993 response to lipid
GO:0034644 cellular response to UV
GO:0044849 estrous cycle
GO:0045739 positive regulation of DNA repair
GO:0045740 positive regulation of DNA replication
GO:0046686 response to cadmium ion
GO:0070301 cellular response to hydrogen peroxide
GO:0071466 cellular response to xenobiotic stimulus
GO:0071548 response to dexamethasone
GO:0097421 liver regeneration
GO:1900264 positive regulation of DNA-directed DNA polymerase activity
GO:1902065 response to L-glutamate
GO:1902990 mitotic telomere maintenance via semi-conservative replication
Cellular Component
GO:0000307 cyclin-dependent protein kinase holoenzyme complex
GO:0000781 chromosome, telomeric region
GO:0000785 chromatin
GO:0001673 male germ cell nucleus
GO:0005634 nucleus
GO:0005652 nuclear lamina
GO:0005654 nucleoplasm
GO:0005657 replication fork
GO:0005813 centrosome
GO:0016604 nuclear body
GO:0030894 replisome
GO:0043596 nuclear replication fork
GO:0043626 PCNA complex
GO:0070062 extracellular exosome
GO:0070557 PCNA-p21 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m5n, PDBe:7m5n, PDBj:7m5n
PDBsum7m5n
PubMed34704055
UniProtP12004|PCNA_HUMAN Proliferating cell nuclear antigen (Gene Name=PCNA)

[Back to BioLiP]