Structure of PDB 7l4y Chain B Binding Site BS02

Receptor Information
>7l4y Chain B (length=164) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TSKLKYVLQDARFFLIKSNNHENVSLAKAKGVWSTLPVNEKKLNLAFRSA
RSVILIFSVRESGKFQGFARLSSESHHGGSPIHWVLPAGMSAKMLGGVFK
IDWICRRELPFTKSAHLTNPWNEHKPVKIGRDGQEIELECGTQLCLLFPP
DESIDLYQVIHKMR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7l4y Human MettL3-MettL14 RNA adenine methyltransferase complex is active on double-stranded DNA containing lesions.
Resolution1.79 Å
Binding residue
(original residue number in PDB)		K361 S362 N363 N367 W377 S378 L380 V382 R404 E405 W428 P431 K472 G474 R475 D476
Binding residue
(residue number reindexed from 1)		K17 S18 N19 N23 W33 S34 L36 V38 R60 E61 W84 P87 K128 G130 R131 D132
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7l4y, PDBe:7l4y, PDBj:7l4y
PDBsum7l4y
PubMed34086966
UniProtQ96MU7|YTDC1_HUMAN YTH domain-containing protein 1 (Gene Name=YTHDC1)

[Back to BioLiP]