Structure of PDB 7kry Chain B Binding Site BS02

Receptor Information

>7kry Chain B (length=84) Species: 10090 (Mus musculus)

SKPFTCLDGTATIPFDQVNDDYCDCKDGSDEPGTAACPNGSFHCTNTGYK
PLYILSSRVNDGVCDCCDGTDEYNSGTVCENTCR

Ligand information

• Ligand ID: CA
• InChI: InChI=1S/Ca/q+2
• InChIKey: BHPQYMZQTOCNFJ-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Ca++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Ca+2]
• Formula: Ca
• Name: CALCIUM ION
• DrugBank: DB14577
• PDB chain: 7kry Chain B Residue 602

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7kry N-Substituted Valiolamine Derivatives as Potent Inhibitors of Endoplasmic Reticulum alpha-Glucosidases I and II with Antiviral Activity.
• Resolution: 2.55 Å
• Binding residue (original residue number in PDB): R91 D94 V96 D98 D104 E105
• Binding residue (residue number reindexed from 1): R58 D61 V63 D65 D71 E72
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005509 calcium ion binding
• GO:0005515 protein binding
• GO:0044877 protein-containing complex binding
• GO:0046872 metal ion binding

Biological Process

• GO:0001701 in utero embryonic development
• GO:0001889 liver development
• GO:0006491 N-glycan processing
• GO:0010977 negative regulation of neuron projection development
• GO:0071941 nitrogen cycle metabolic process

Cellular Component

• GO:0005783 endoplasmic reticulum
• GO:0017177 glucosidase II complex
• GO:0043231 intracellular membrane-bounded organelle

External links

• PDB: RCSB:7kry, PDBe:7kry, PDBj:7kry
• PDBsum: 7kry
• PubMed: 34870992
• UniProt: O08795|GLU2B_MOUSE Glucosidase 2 subunit beta (Gene Name=Prkcsh)