Structure of PDB 7jzp Chain B Binding Site BS02

Receptor Information
>7jzp Chain B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVG
DAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jzp CFTR Associated Ligand (CAL) PDZ domain bound to peptidomimetic LyCALBF
Resolution1.95 Å
Binding residue
(original residue number in PDB)		G290 L291 I293 S294 I295 T296 G297 H301 H341 V345
Binding residue
(residue number reindexed from 1)		G15 L16 I18 S19 I20 T21 G22 H26 H66 V70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005794 Golgi apparatus

View graph for
Cellular Component
External links
PDB RCSB:7jzp, PDBe:7jzp, PDBj:7jzp
PDBsum7jzp
PubMed
UniProtQ9HD26|GOPC_HUMAN Golgi-associated PDZ and coiled-coil motif-containing protein (Gene Name=GOPC)

[Back to BioLiP]